Placeholder image of a protein
Icon representing a puzzle

2563: Electron Density Reconstruction 105

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
January 15, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do another more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQEVRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,855
  1. Avatar for carsonfb 31. carsonfb Lv 1 5 pts. 35,758
  2. Avatar for roarshock 32. roarshock Lv 1 4 pts. 35,756
  3. Avatar for altaris 33. altaris Lv 1 4 pts. 35,676
  4. Avatar for zbp 34. zbp Lv 1 3 pts. 35,662
  5. Avatar for Crossed Sticks 35. Crossed Sticks Lv 1 3 pts. 35,654
  6. Avatar for Dr.Sillem 36. Dr.Sillem Lv 1 2 pts. 35,651
  7. Avatar for kitsoune 37. kitsoune Lv 1 2 pts. 35,635
  8. Avatar for Hexafluorouranate 38. Hexafluorouranate Lv 1 2 pts. 35,619
  9. Avatar for vybi 39. vybi Lv 1 2 pts. 35,600
  10. Avatar for Trajan464 40. Trajan464 Lv 1 1 pt. 35,538

Comments