Placeholder image of a protein
Icon representing a puzzle

2563: Electron Density Reconstruction 105

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
January 15, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do another more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQEVRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,855

  1. Avatar for mnucer 41. mnucer Lv 1 1 pt. 35,495
  2. Avatar for Th1sN@me!sN0tAPun 42. Th1sN@me!sN0tAPun Lv 1 1 pt. 35,459
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 1 pt. 35,388
  4. Avatar for ProfVince 44. ProfVince Lv 1 1 pt. 35,089
  5. Avatar for Larini 45. Larini Lv 1 1 pt. 35,028
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 1 pt. 35,012
  7. Avatar for pfirth 47. pfirth Lv 1 1 pt. 34,894
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 1 pt. 34,629
  9. Avatar for TheGUmmer 49. TheGUmmer Lv 1 1 pt. 34,611
  10. Avatar for carxo 50. carxo Lv 1 1 pt. 34,161

Comments