Placeholder image of a protein
Icon representing a puzzle

2563: Electron Density Reconstruction 105

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 15, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do another more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQEVRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,855

  1. Avatar for DScott 51. DScott Lv 1 1 pt. 34,131
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 34,117
  3. Avatar for efull 53. efull Lv 1 1 pt. 34,066
  4. Avatar for melonogaster 54. melonogaster Lv 1 1 pt. 34,061
  5. Avatar for RWoodcock 55. RWoodcock Lv 1 1 pt. 33,961
  6. Avatar for mvnnrtwck 56. mvnnrtwck Lv 1 1 pt. 33,955
  7. Avatar for LAPUZZAANDREA 57. LAPUZZAANDREA Lv 1 1 pt. 33,938
  8. Avatar for rinze 58. rinze Lv 1 1 pt. 33,910
  9. Avatar for ksnmk 59. ksnmk Lv 1 1 pt. 33,686
  10. Avatar for carlitosboy15 60. carlitosboy15 Lv 1 1 pt. 33,669

Comments