2563: Electron Density Reconstruction 105
Closed since about 1 year ago
Novice Novice Overall Overall Prediction Prediction Electron Density Electron DensitySummary
- Created
- January 15, 2025
- Expires
- Max points
- 100
We're going to take a break from the Refine Density puzzles to do another more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.
- Sequence
- ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQEVRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD
Top groups
-
100 pts. 37,370
-
-
-
-
-
-
-
-
-