Placeholder image of a protein
Icon representing a puzzle

2563: Electron Density Reconstruction 105

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
January 15, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do another more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQEVRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 37,370
  2. Avatar for Go Science 2. Go Science 60 pts. 37,328
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 37,315
  4. Avatar for Contenders 4. Contenders 17 pts. 37,231
  5. Avatar for Australia 5. Australia 8 pts. 36,744
  6. Avatar for VeFold 6. VeFold 4 pts. 36,712
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 36,480
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 36,191
  9. Avatar for Kotocycle 9. Kotocycle 1 pt. 36,075
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 34,611
  1. Avatar for Sydefecks 61. Sydefecks Lv 1 1 pt. 32,355
  2. Avatar for TurnerK25 62. TurnerK25 Lv 1 1 pt. 31,848
  3. Avatar for Sammy3c2b1a0 63. Sammy3c2b1a0 Lv 1 1 pt. 22,855
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 786
  5. Avatar for kmcintosh 65. kmcintosh Lv 1 1 pt. 786

Comments