Icon representing a puzzle

2565: Revisiting Puzzle 91: Virus Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
January 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,039
  2. Avatar for Team China 12. Team China 1 pt. 8,649
  3. Avatar for incognito group 13. incognito group 1 pt. 7,756

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,561
  2. Avatar for orily1337 2. orily1337 Lv 1 93 pts. 10,488
  3. Avatar for Serca 3. Serca Lv 1 86 pts. 10,413
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 80 pts. 10,409
  5. Avatar for meatexplosion 5. meatexplosion Lv 1 74 pts. 10,385
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 68 pts. 10,352
  7. Avatar for WBarme1234 7. WBarme1234 Lv 1 63 pts. 10,339
  8. Avatar for Museka 8. Museka Lv 1 58 pts. 10,338
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 53 pts. 10,309
  10. Avatar for bravosk8erboy 10. bravosk8erboy Lv 1 49 pts. 10,263

Comments