Placeholder image of a protein
Icon representing a puzzle

2570: Electron Density Reconstruction 107

Closed since about 1 year ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
January 30, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ

Top groups


  1. Avatar for Team Canada 12. Team Canada 1 pt. 14,316
  2. Avatar for Russian team 13. Russian team 1 pt. 14,115

  1. Avatar for BootsMcGraw
    1. BootsMcGraw Lv 1
    100 pts. 70,922
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 70,872
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 87 pts. 70,780
  4. Avatar for LociOiling 4. LociOiling Lv 1 81 pts. 70,640
  5. Avatar for spvincent 5. spvincent Lv 1 75 pts. 70,592
  6. Avatar for grogar7 6. grogar7 Lv 1 70 pts. 70,474
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 64 pts. 70,455
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 60 pts. 70,420
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 55 pts. 70,322
  10. Avatar for Galaxie 10. Galaxie Lv 1 51 pts. 70,273

Comments