Placeholder image of a protein
Icon representing a puzzle

2570: Electron Density Reconstruction 107

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 30, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ

Top groups


  1. Avatar for Team Canada 12. Team Canada 1 pt. 14,316
  2. Avatar for Russian team 13. Russian team 1 pt. 14,115

  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 47 pts. 70,152
  2. Avatar for gmn 12. gmn Lv 1 43 pts. 70,134
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 40 pts. 70,122
  4. Avatar for meatexplosion 14. meatexplosion Lv 1 36 pts. 69,654
  5. Avatar for BarrySampson 15. BarrySampson Lv 1 33 pts. 69,652
  6. Avatar for TheGUmmer 16. TheGUmmer Lv 1 30 pts. 69,628
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 28 pts. 69,456
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 25 pts. 69,283
  9. Avatar for jamiexq 19. jamiexq Lv 1 23 pts. 69,093
  10. Avatar for akaaka 20. akaaka Lv 1 21 pts. 69,047

Comments