Placeholder image of a protein
Icon representing a puzzle

2570: Electron Density Reconstruction 107

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
January 30, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ

Top groups


  1. Avatar for Team Canada 12. Team Canada 1 pt. 14,316
  2. Avatar for Russian team 13. Russian team 1 pt. 14,115

  1. Avatar for alcor29 21. alcor29 Lv 1 19 pts. 69,034
  2. Avatar for georg137 22. georg137 Lv 1 17 pts. 68,374
  3. Avatar for nicobul 23. nicobul Lv 1 16 pts. 68,272
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 14 pts. 68,090
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 13 pts. 68,060
  6. Avatar for Trajan464 26. Trajan464 Lv 1 11 pts. 67,998
  7. Avatar for toshiue 27. toshiue Lv 1 10 pts. 67,662
  8. Avatar for ShadowTactics 28. ShadowTactics Lv 1 9 pts. 67,635
  9. Avatar for manu8170 29. manu8170 Lv 1 8 pts. 67,532
  10. Avatar for ProfVince 30. ProfVince Lv 1 7 pts. 67,426

Comments