Placeholder image of a protein
Icon representing a puzzle

2570: Electron Density Reconstruction 107

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 30, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ

Top groups


  1. Avatar for Team Canada 12. Team Canada 1 pt. 14,316
  2. Avatar for Russian team 13. Russian team 1 pt. 14,115

  1. Avatar for rosie4loop 51. rosie4loop Lv 1 1 pt. 58,717
  2. Avatar for RWoodcock 52. RWoodcock Lv 1 1 pt. 58,560
  3. Avatar for froschi2 53. froschi2 Lv 1 1 pt. 58,283
  4. Avatar for Sydefecks 54. Sydefecks Lv 1 1 pt. 58,233
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 57,435
  6. Avatar for abiogenesis 56. abiogenesis Lv 1 1 pt. 57,169
  7. Avatar for Swapper242 57. Swapper242 Lv 1 1 pt. 56,183
  8. Avatar for altaris 58. altaris Lv 1 1 pt. 55,317
  9. Avatar for furi0us 59. furi0us Lv 1 1 pt. 53,354
  10. Avatar for MissGinko 60. MissGinko Lv 1 1 pt. 50,455

Comments