Placeholder image of a protein
Icon representing a puzzle

2570: Electron Density Reconstruction 107

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 30, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ

Top groups


  1. Avatar for Team Canada 12. Team Canada 1 pt. 14,316
  2. Avatar for Russian team 13. Russian team 1 pt. 14,115

  1. Avatar for Sammy3c2b1a0 61. Sammy3c2b1a0 Lv 1 1 pt. 42,909
  2. Avatar for melonogaster 62. melonogaster Lv 1 1 pt. 39,087
  3. Avatar for Guinea_Pig_Lord 63. Guinea_Pig_Lord Lv 1 1 pt. 24,978
  4. Avatar for Bronypedia 64. Bronypedia Lv 1 1 pt. 17,442
  5. Avatar for duyanh0511 65. duyanh0511 Lv 1 1 pt. 16,906
  6. Avatar for UKROP 66. UKROP Lv 1 1 pt. 14,378
  7. Avatar for SyntheticAnimal 67. SyntheticAnimal Lv 1 1 pt. 14,316
  8. Avatar for nasiff038 68. nasiff038 Lv 1 1 pt. 14,115
  9. Avatar for Siraphat 69. Siraphat Lv 1 1 pt. 14,115
  10. Avatar for Gerom 70. Gerom Lv 1 1 pt. 14,115

Comments