Placeholder image of a protein
Icon representing a puzzle

2570: Electron Density Reconstruction 107

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
January 30, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a bit large, so we would recommend the trim tool on this one.

Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ

Top groups


  1. Avatar for Contenders 100 pts. 71,258
  2. Avatar for Go Science 2. Go Science 65 pts. 70,872
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 70,640
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 70,322
  5. Avatar for VeFold 5. VeFold 14 pts. 69,652
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 69,628
  7. Avatar for Australia 7. Australia 4 pts. 69,456
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 69,283
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 67,635
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 61,130

  1. Avatar for Crossed Sticks 41. Crossed Sticks Lv 1 2 pts. 61,148
  2. Avatar for Savas 42. Savas Lv 1 2 pts. 61,130
  3. Avatar for Hexafluorouranate 43. Hexafluorouranate Lv 1 2 pts. 61,092
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 1 pt. 60,693
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 60,691
  6. Avatar for Alistair69 46. Alistair69 Lv 1 1 pt. 60,630
  7. Avatar for fisherlr777 47. fisherlr777 Lv 1 1 pt. 60,244
  8. Avatar for Mohoernchen 48. Mohoernchen Lv 1 1 pt. 60,198
  9. Avatar for maithra 49. maithra Lv 1 1 pt. 60,104
  10. Avatar for pfirth 50. pfirth Lv 1 1 pt. 59,075

Comments