Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,865
  2. Avatar for BIOTF345 12. BIOTF345 1 pt. 7,955
  3. Avatar for BIOF215 13. BIOF215 1 pt. 7,549

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,012
  2. Avatar for akaaka 2. akaaka Lv 1 95 pts. 10,009
  3. Avatar for LociOiling 3. LociOiling Lv 1 90 pts. 10,000
  4. Avatar for Serca 4. Serca Lv 1 85 pts. 9,963
  5. Avatar for meatexplosion 5. meatexplosion Lv 1 80 pts. 9,895
  6. Avatar for orily1337 6. orily1337 Lv 1 76 pts. 9,887
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 71 pts. 9,881
  8. Avatar for grogar7 8. grogar7 Lv 1 67 pts. 9,874
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 63 pts. 9,868
  10. Avatar for bravosk8erboy 10. bravosk8erboy Lv 1 60 pts. 9,843

Comments


beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it