Placeholder image of a protein
Icon representing a puzzle

2572: Electron Density Reconstruction 108

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
February 05, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a quite large, so we would recommend the trim tool on this one. This one also has a big piece of DNA in it!

Sequence
MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRDKRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN MDKLGENLNKALNKLKAAAFVDKKLIKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSKKEHIIKIVYEELVKLLGEEAKKLELNPKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYRPAAYEQLKQLAEKIHVPIYGDETRTKSPVDIVKEGMEKFKKADVLIIDTAGRHKEEKGLLEEMKQIKEITNPDEIILVIDGTIGQQAGIQAKAFKEAVGEIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLEPFDPKKFISRLLGMGDLESLLEKAEDMVDEKTEESIDAIMRGKFTLNELMTQLEAIENMGSMKKILSMIPGFGGAMPKELSHLTEAKIKKYKVIISSMTKEERENPKIIKASRIRRIARGSGTTENDVREVLRYYETTKNAIDKLRKGKSGSGGSGSGKLALALLLLLLALAL GUCUCGUCCCGUGGGGCUCGGCGGUGGGGGAGCAUCUCCUGUAGGGGAGAUGUAACCCCCUUUACCUGCCGAACCCCGCCAGGCCCGGAAGGGAGCAACGGUAGGCAGGACGUCGGCGCUCACGGGGGUGCGGGAC

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 78,585
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 76,574
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 54,155
  4. Avatar for chemiosmotic 14. chemiosmotic 1 pt. 51,673

  1. Avatar for NPrincipi 31. NPrincipi Lv 1 10 pts. 82,912
  2. Avatar for pizpot 32. pizpot Lv 1 9 pts. 82,863
  3. Avatar for maithra 33. maithra Lv 1 8 pts. 82,625
  4. Avatar for Crossed Sticks 34. Crossed Sticks Lv 1 7 pts. 82,230
  5. Avatar for ProfVince 35. ProfVince Lv 1 6 pts. 82,187
  6. Avatar for hookedwarm 36. hookedwarm Lv 1 6 pts. 81,683
  7. Avatar for zbp 37. zbp Lv 1 5 pts. 81,609
  8. Avatar for Hellcat6 38. Hellcat6 Lv 1 5 pts. 81,074
  9. Avatar for georg137 39. georg137 Lv 1 4 pts. 80,805
  10. Avatar for Bruno Kestemont 40. Bruno Kestemont Lv 1 4 pts. 80,263

Comments


LociOiling Lv 1

Don't be fooled, the non-protein in this puzzle is RNA, not DNA, despite the fact it forms a double helix of sorts. It's all one chain, so no sense and anti-sense to worry about.

One interesting feature of RNA is that you can't cut it. You'll see an "action not permitted on RNA" message if you try cutting it in the GUI.

For RNA, the function structure.GetDistance ( a, b ) returns the distance between atom 1 in segment a and atom 1 in segment b.

LociOiling Lv 1

Just to be clear, for DNA and RNA, structure.GetDistance ( a, a +1 ) gives the distance between the phosphorus atom of one nucleobase (a) and the next nucleobase (a + 1).