Placeholder image of a protein
Icon representing a puzzle

2572: Electron Density Reconstruction 108

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
February 05, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a quite large, so we would recommend the trim tool on this one. This one also has a big piece of DNA in it!

Sequence
MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRDKRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN MDKLGENLNKALNKLKAAAFVDKKLIKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSKKEHIIKIVYEELVKLLGEEAKKLELNPKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYRPAAYEQLKQLAEKIHVPIYGDETRTKSPVDIVKEGMEKFKKADVLIIDTAGRHKEEKGLLEEMKQIKEITNPDEIILVIDGTIGQQAGIQAKAFKEAVGEIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLEPFDPKKFISRLLGMGDLESLLEKAEDMVDEKTEESIDAIMRGKFTLNELMTQLEAIENMGSMKKILSMIPGFGGAMPKELSHLTEAKIKKYKVIISSMTKEERENPKIIKASRIRRIARGSGTTENDVREVLRYYETTKNAIDKLRKGKSGSGGSGSGKLALALLLLLLALAL GUCUCGUCCCGUGGGGCUCGGCGGUGGGGGAGCAUCUCCUGUAGGGGAGAUGUAACCCCCUUUACCUGCCGAACCCCGCCAGGCCCGGAAGGGAGCAACGGUAGGCAGGACGUCGGCGCUCACGGGGGUGCGGGAC

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 78,585
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 76,574
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 54,155
  4. Avatar for chemiosmotic 14. chemiosmotic 1 pt. 51,673
  1. Avatar for breadwallet 61. breadwallet Lv 1 1 pt. 71,397
  2. Avatar for SuperPedro35 62. SuperPedro35 Lv 1 1 pt. 69,515
  3. Avatar for prkfour 63. prkfour Lv 1 1 pt. 67,427
  4. Avatar for lordveznan 64. lordveznan Lv 1 1 pt. 65,441
  5. Avatar for melonogaster 65. melonogaster Lv 1 1 pt. 64,431
  6. Avatar for nikoahmed 66. nikoahmed Lv 1 1 pt. 61,662
  7. Avatar for Sammy3c2b1a0 67. Sammy3c2b1a0 Lv 1 1 pt. 54,155
  8. Avatar for Kvaksius 68. Kvaksius Lv 1 1 pt. 51,673
  9. Avatar for 6ie454yt55wn 69. 6ie454yt55wn Lv 1 1 pt. 40,322
  10. Avatar for dimmoooooooo00 70. dimmoooooooo00 Lv 1 1 pt. 30,239

Comments

LociOiling Lv 1

Don't be fooled, the non-protein in this puzzle is RNA, not DNA, despite the fact it forms a double helix of sorts. It's all one chain, so no sense and anti-sense to worry about.

One interesting feature of RNA is that you can't cut it. You'll see an "action not permitted on RNA" message if you try cutting it in the GUI.

For RNA, the function structure.GetDistance ( a, b ) returns the distance between atom 1 in segment a and atom 1 in segment b.

LociOiling Lv 1

Just to be clear, for DNA and RNA, structure.GetDistance ( a, a +1 ) gives the distance between the phosphorus atom of one nucleobase (a) and the next nucleobase (a + 1).