Placeholder image of a protein
Icon representing a puzzle

2572: Electron Density Reconstruction 108

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
February 05, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a quite large, so we would recommend the trim tool on this one. This one also has a big piece of DNA in it!

Sequence
MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRDKRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN MDKLGENLNKALNKLKAAAFVDKKLIKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSKKEHIIKIVYEELVKLLGEEAKKLELNPKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYRPAAYEQLKQLAEKIHVPIYGDETRTKSPVDIVKEGMEKFKKADVLIIDTAGRHKEEKGLLEEMKQIKEITNPDEIILVIDGTIGQQAGIQAKAFKEAVGEIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLEPFDPKKFISRLLGMGDLESLLEKAEDMVDEKTEESIDAIMRGKFTLNELMTQLEAIENMGSMKKILSMIPGFGGAMPKELSHLTEAKIKKYKVIISSMTKEERENPKIIKASRIRRIARGSGTTENDVREVLRYYETTKNAIDKLRKGKSGSGGSGSGKLALALLLLLLALAL GUCUCGUCCCGUGGGGCUCGGCGGUGGGGGAGCAUCUCCUGUAGGGGAGAUGUAACCCCCUUUACCUGCCGAACCCCGCCAGGCCCGGAAGGGAGCAACGGUAGGCAGGACGUCGGCGCUCACGGGGGUGCGGGAC

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 87,702
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 86,984
  3. Avatar for Go Science 3. Go Science 44 pts. 86,372
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 86,150
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 85,578
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 85,398
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 85,158
  8. Avatar for Australia 8. Australia 3 pts. 85,140
  9. Avatar for VeFold 9. VeFold 1 pt. 84,524
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 83,284
  1. Avatar for Kimdonghyeon 71. Kimdonghyeon Lv 1 1 pt. 29,048
  2. Avatar for Massin 72. Massin Lv 1 1 pt. 28,717
  3. Avatar for B17flying forterss 73. B17flying forterss Lv 1 1 pt. 25,941
  4. Avatar for xa31 74. xa31 Lv 1 1 pt. 24,950
  5. Avatar for Jacloch 75. Jacloch Lv 1 1 pt. 23,276
  6. Avatar for nede123 76. nede123 Lv 1 1 pt. 23,185
  7. Avatar for Luca 77. Luca Lv 1 1 pt. 23,185
  8. Avatar for UrLostSock 78. UrLostSock Lv 1 1 pt. 23,185
  9. Avatar for erob08 79. erob08 Lv 1 1 pt. 23,185
  10. Avatar for SWR_DMaster 80. SWR_DMaster Lv 1 1 pt. 23,185

Comments

LociOiling Lv 1

Don't be fooled, the non-protein in this puzzle is RNA, not DNA, despite the fact it forms a double helix of sorts. It's all one chain, so no sense and anti-sense to worry about.

One interesting feature of RNA is that you can't cut it. You'll see an "action not permitted on RNA" message if you try cutting it in the GUI.

For RNA, the function structure.GetDistance ( a, b ) returns the distance between atom 1 in segment a and atom 1 in segment b.

LociOiling Lv 1

Just to be clear, for DNA and RNA, structure.GetDistance ( a, a +1 ) gives the distance between the phosphorus atom of one nucleobase (a) and the next nucleobase (a + 1).