Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,591
  2. Avatar for Russian team 12. Russian team 1 pt. 9,358
  3. Avatar for chemiosmotic 13. chemiosmotic 1 pt. 9,056
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,723
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 8,000
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,645
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 10,520
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 89 pts. 10,397
  4. Avatar for grogar7 4. grogar7 Lv 1 84 pts. 10,362
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 79 pts. 10,331
  6. Avatar for meatexplosion 6. meatexplosion Lv 1 74 pts. 10,295
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 70 pts. 10,294
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 66 pts. 10,249
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 62 pts. 10,201
  10. Avatar for gmn 10. gmn Lv 1 58 pts. 10,171

Comments