Icon representing a puzzle

2576: Revisiting Puzzle 95: Chicken

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
February 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,931

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,806
  2. Avatar for Serca 2. Serca Lv 1 93 pts. 10,790
  3. Avatar for grogar7 3. grogar7 Lv 1 87 pts. 10,761
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 80 pts. 10,662
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 74 pts. 10,632
  6. Avatar for Galaxie 6. Galaxie Lv 1 69 pts. 10,603
  7. Avatar for BootsMcGraw 7. BootsMcGraw Lv 1 64 pts. 10,581
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 59 pts. 10,572
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 54 pts. 10,560
  10. Avatar for akaaka 10. akaaka Lv 1 50 pts. 10,558

Comments