Icon representing a puzzle

2576: Revisiting Puzzle 95: Chicken

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,806
  2. Avatar for Go Science 2. Go Science 60 pts. 10,790
  3. Avatar for Contenders 3. Contenders 33 pts. 10,581
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 10,549
  5. Avatar for Australia 5. Australia 8 pts. 10,459
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 10,399
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 10,366
  8. Avatar for VeFold 8. VeFold 1 pt. 10,330
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,809
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,512
  1. Avatar for Sammy3c2b1a0 61. Sammy3c2b1a0 Lv 1 1 pt. 8,931
  2. Avatar for furi0us 62. furi0us Lv 1 1 pt. 8,908
  3. Avatar for Tehnologik1 63. Tehnologik1 Lv 1 1 pt. 7,609
  4. Avatar for binoa 64. binoa Lv 1 1 pt. 6,475
  5. Avatar for Evilhikaru 65. Evilhikaru Lv 1 1 pt. 6,258
  6. Avatar for pontoon 66. pontoon Lv 1 1 pt. 6,181
  7. Avatar for rutgerr 67. rutgerr Lv 1 1 pt. 5,516
  8. Avatar for glaminator 68. glaminator Lv 1 1 pt. 4,167
  9. Avatar for toshiue 69. toshiue Lv 1 1 pt. 2,862

Comments