Icon representing a puzzle

2575: Unsolved Voltage-gated Ion Channel Cryo-EM Density Round 2

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
February 19, 2025
Expires
Max points
100
Description

Here's round 2 for this exciting puzzle. While our collaborators have been able to fit a cryoEM map well enough to build an atomic model of this channel (chain A in this puzzle) they have been unable to fit the toxin variant (chain B). Try to fit both chains into this cryo-EM map, but especially residues 119-148 (chain B, where constraints have been added between 127&139, 120&134, and 133&143). See the previous blogpost for all the juicy scientific details!
NOTE: The latest client is needed to run this puzzle.

Blogpost: https://fold.it/forum/blog/new-unsolved-vgic-cryo-em-density-puzzle
Previous Round: https://fold.it/puzzles/2013979

Sequence
PYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKL QCQKWMQTCDKDRKCCEGFRCRLWCRKELL

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 17,446
  2. Avatar for Team China 12. Team China 1 pt. 17,163
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 16,971
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 16,871
  5. Avatar for SHELL 15. SHELL 1 pt. 16,865
  1. Avatar for BotError404 41. BotError404 Lv 1 9 pts. 17,915
  2. Avatar for pizpot 42. pizpot Lv 1 8 pts. 17,847
  3. Avatar for SuperEnzyme 43. SuperEnzyme Lv 1 8 pts. 17,837
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 7 pts. 17,830
  5. Avatar for BilNeutron 45. BilNeutron Lv 1 6 pts. 17,810
  6. Avatar for Trajan464 46. Trajan464 Lv 1 6 pts. 17,807
  7. Avatar for mnucer 47. mnucer Lv 1 5 pts. 17,765
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 5 pts. 17,714
  9. Avatar for Zenith101 49. Zenith101 Lv 1 5 pts. 17,701
  10. Avatar for rosie4loop 50. rosie4loop Lv 1 4 pts. 17,682

Comments

beta_helix Staff Lv 1

This puzzle is open for 2 weeks to give you enough time to solve Round 2 of this Unsolved VGIC Cryo-EM Density Puzzle!

Note that there is no Refine Density tool in this puzzle, because there is no way to refine this density… the electron density cloud comes from cryo-EM, not X-ray crystallography, so we only have this one "image" of the density to work with. Good luck!

Thanks to LociOiling's post:
The puzzle has constraints on three disulfide bridges.

The bridges are:

127,139 120,134 133,143

The constraints are invisible if the bridges are in place. They only become visible if you move the sidechains apart to break the bridge.
https://fold.it/puzzles/2014026#post_79759