Icon representing a puzzle

2575: Unsolved Voltage-gated Ion Channel Cryo-EM Density Round 2

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 19, 2025
Expires
Max points
100
Description

Here's round 2 for this exciting puzzle. While our collaborators have been able to fit a cryoEM map well enough to build an atomic model of this channel (chain A in this puzzle) they have been unable to fit the toxin variant (chain B). Try to fit both chains into this cryo-EM map, but especially residues 119-148 (chain B, where constraints have been added between 127&139, 120&134, and 133&143). See the previous blogpost for all the juicy scientific details!
NOTE: The latest client is needed to run this puzzle.

Blogpost: https://fold.it/forum/blog/new-unsolved-vgic-cryo-em-density-puzzle
Previous Round: https://fold.it/puzzles/2013979

Sequence
PYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKL QCQKWMQTCDKDRKCCEGFRCRLWCRKELL

Top groups


  1. Avatar for GENE 433 11. GENE 433 1 pt. 17,446
  2. Avatar for Team China 12. Team China 1 pt. 17,163
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 16,971
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 16,871
  5. Avatar for SHELL 15. SHELL 1 pt. 16,865

  1. Avatar for BotError404 41. BotError404 Lv 1 9 pts. 17,915
  2. Avatar for pizpot 42. pizpot Lv 1 8 pts. 17,847
  3. Avatar for SuperEnzyme 43. SuperEnzyme Lv 1 8 pts. 17,837
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 7 pts. 17,830
  5. Avatar for BilNeutron 45. BilNeutron Lv 1 6 pts. 17,810
  6. Avatar for Trajan464 46. Trajan464 Lv 1 6 pts. 17,807
  7. Avatar for mnucer 47. mnucer Lv 1 5 pts. 17,765
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 5 pts. 17,714
  9. Avatar for Zenith101 49. Zenith101 Lv 1 5 pts. 17,701
  10. Avatar for rosie4loop 50. rosie4loop Lv 1 4 pts. 17,682

Comments


beta_helix Staff Lv 1

This puzzle is open for 2 weeks to give you enough time to solve Round 2 of this Unsolved VGIC Cryo-EM Density Puzzle!

Note that there is no Refine Density tool in this puzzle, because there is no way to refine this density… the electron density cloud comes from cryo-EM, not X-ray crystallography, so we only have this one "image" of the density to work with. Good luck!

Thanks to LociOiling's post:
The puzzle has constraints on three disulfide bridges.

The bridges are:

127,139 120,134 133,143

The constraints are invisible if the bridges are in place. They only become visible if you move the sidechains apart to break the bridge.
https://fold.it/puzzles/2014026#post_79759