Icon representing a puzzle

2575: Unsolved Voltage-gated Ion Channel Cryo-EM Density Round 2

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
February 19, 2025
Expires
Max points
100
Description

Here's round 2 for this exciting puzzle. While our collaborators have been able to fit a cryoEM map well enough to build an atomic model of this channel (chain A in this puzzle) they have been unable to fit the toxin variant (chain B). Try to fit both chains into this cryo-EM map, but especially residues 119-148 (chain B, where constraints have been added between 127&139, 120&134, and 133&143). See the previous blogpost for all the juicy scientific details!
NOTE: The latest client is needed to run this puzzle.

Blogpost: https://fold.it/forum/blog/new-unsolved-vgic-cryo-em-density-puzzle
Previous Round: https://fold.it/puzzles/2013979

Sequence
PYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKL QCQKWMQTCDKDRKCCEGFRCRLWCRKELL

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 17,446
  2. Avatar for Team China 12. Team China 1 pt. 17,163
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 16,971
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 16,871
  5. Avatar for SHELL 15. SHELL 1 pt. 16,865
  1. Avatar for Alistair69 61. Alistair69 Lv 1 2 pts. 17,396
  2. Avatar for Larini 62. Larini Lv 1 2 pts. 17,375
  3. Avatar for Vinara 63. Vinara Lv 1 1 pt. 17,352
  4. Avatar for haleyg 64. haleyg Lv 1 1 pt. 17,344
  5. Avatar for wosser1 65. wosser1 Lv 1 1 pt. 17,318
  6. Avatar for kitsoune 66. kitsoune Lv 1 1 pt. 17,282
  7. Avatar for froschi2 67. froschi2 Lv 1 1 pt. 17,271
  8. Avatar for Merf 68. Merf Lv 1 1 pt. 17,252
  9. Avatar for carxo 69. carxo Lv 1 1 pt. 17,241
  10. Avatar for zo3xiaJonWeinberg 70. zo3xiaJonWeinberg Lv 1 1 pt. 17,163

Comments

beta_helix Staff Lv 1

This puzzle is open for 2 weeks to give you enough time to solve Round 2 of this Unsolved VGIC Cryo-EM Density Puzzle!

Note that there is no Refine Density tool in this puzzle, because there is no way to refine this density… the electron density cloud comes from cryo-EM, not X-ray crystallography, so we only have this one "image" of the density to work with. Good luck!

Thanks to LociOiling's post:
The puzzle has constraints on three disulfide bridges.

The bridges are:

127,139 120,134 133,143

The constraints are invisible if the bridges are in place. They only become visible if you move the sidechains apart to break the bridge.
https://fold.it/puzzles/2014026#post_79759