Icon representing a puzzle

2575: Unsolved Voltage-gated Ion Channel Cryo-EM Density Round 2

Closed since about 1 year ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
February 19, 2025
Expires
Max points
100
Description

Here's round 2 for this exciting puzzle. While our collaborators have been able to fit a cryoEM map well enough to build an atomic model of this channel (chain A in this puzzle) they have been unable to fit the toxin variant (chain B). Try to fit both chains into this cryo-EM map, but especially residues 119-148 (chain B, where constraints have been added between 127&139, 120&134, and 133&143). See the previous blogpost for all the juicy scientific details!
NOTE: The latest client is needed to run this puzzle.

Blogpost: https://fold.it/forum/blog/new-unsolved-vgic-cryo-em-density-puzzle
Previous Round: https://fold.it/puzzles/2013979

Sequence
PYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKL QCQKWMQTCDKDRKCCEGFRCRLWCRKELL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 18,852
  2. Avatar for Go Science 2. Go Science 70 pts. 18,782
  3. Avatar for Contenders 3. Contenders 47 pts. 18,735
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 18,665
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 18,647
  6. Avatar for Australia 6. Australia 11 pts. 18,628
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 18,602
  8. Avatar for VeFold 8. VeFold 4 pts. 18,563
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 2 pts. 18,341
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 18,183

  1. Avatar for gmn
    1. gmn Lv 1
    100 pts. 18,827
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 18,806
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 91 pts. 18,782
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 87 pts. 18,735
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 82 pts. 18,726
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 78 pts. 18,722
  7. Avatar for Galaxie 7. Galaxie Lv 1 74 pts. 18,678
  8. Avatar for BootsMcGraw 8. BootsMcGraw Lv 1 71 pts. 18,677
  9. Avatar for grogar7 9. grogar7 Lv 1 67 pts. 18,668
  10. Avatar for TheGUmmer 10. TheGUmmer Lv 1 64 pts. 18,665

Comments


beta_helix Staff Lv 1

This puzzle is open for 2 weeks to give you enough time to solve Round 2 of this Unsolved VGIC Cryo-EM Density Puzzle!

Note that there is no Refine Density tool in this puzzle, because there is no way to refine this density… the electron density cloud comes from cryo-EM, not X-ray crystallography, so we only have this one "image" of the density to work with. Good luck!

Thanks to LociOiling's post:
The puzzle has constraints on three disulfide bridges.

The bridges are:

127,139 120,134 133,143

The constraints are invisible if the bridges are in place. They only become visible if you move the sidechains apart to break the bridge.
https://fold.it/puzzles/2014026#post_79759