Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,873
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,115
  3. Avatar for SHELL 13. SHELL 1 pt. 8,081
  4. Avatar for porpita porpita 14. porpita porpita 1 pt. 6,256
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,292
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 10,261
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 86 pts. 10,200
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 79 pts. 10,155
  5. Avatar for akaaka 5. akaaka Lv 1 73 pts. 10,113
  6. Avatar for Aubade01 6. Aubade01 Lv 1 67 pts. 10,075
  7. Avatar for TheGUmmer 7. TheGUmmer Lv 1 61 pts. 10,055
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 56 pts. 10,019
  9. Avatar for Simek 9. Simek Lv 1 51 pts. 9,983
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 47 pts. 9,965

Comments