2586: Revisiting Puzzle 110: Turkey
Closed since about 1 year ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- March 20, 2025
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
- Sequence
- AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK