Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since about 1 year ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,447
  2. Avatar for SHELL 12. SHELL 1 pt. 8,225
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,117
  4. Avatar for BearCorp 14. BearCorp 1 pt. 7,600

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,732
  2. Avatar for Serca 2. Serca Lv 1 93 pts. 10,567
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 87 pts. 10,564
  4. Avatar for Galaxie 4. Galaxie Lv 1 81 pts. 10,477
  5. Avatar for BootsMcGraw 5. BootsMcGraw Lv 1 75 pts. 10,460
  6. Avatar for akaaka 6. akaaka Lv 1 69 pts. 10,437
  7. Avatar for Punzi Baker 3 7. Punzi Baker 3 Lv 1 64 pts. 10,418
  8. Avatar for TheGUmmer 8. TheGUmmer Lv 1 59 pts. 10,368
  9. Avatar for meatexplosion 9. meatexplosion Lv 1 55 pts. 10,356
  10. Avatar for AlkiP0Ps 10. AlkiP0Ps Lv 1 50 pts. 10,336

Comments