Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since 12 months ago

Novice Overall Prediction

Summary


Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,447
  2. Avatar for SHELL 12. SHELL 1 pt. 8,225
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,117
  4. Avatar for BearCorp 14. BearCorp 1 pt. 7,600

  1. Avatar for grogar7 11. grogar7 Lv 1 46 pts. 10,332
  2. Avatar for bravosk8erboy 12. bravosk8erboy Lv 1 42 pts. 10,329
  3. Avatar for gmn 13. gmn Lv 1 39 pts. 10,326
  4. Avatar for orily1337 14. orily1337 Lv 1 36 pts. 10,310
  5. Avatar for Aubade01 15. Aubade01 Lv 1 33 pts. 10,307
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 30 pts. 10,282
  7. Avatar for georg137 17. georg137 Lv 1 27 pts. 10,282
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 25 pts. 10,261
  9. Avatar for g_b 19. g_b Lv 1 23 pts. 10,226
  10. Avatar for jamiexq 20. jamiexq Lv 1 20 pts. 10,210

Comments