Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since 12 months ago

Novice Overall Prediction

Summary


Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,447
  2. Avatar for SHELL 12. SHELL 1 pt. 8,225
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,117
  4. Avatar for BearCorp 14. BearCorp 1 pt. 7,600

  1. Avatar for bsz1208 51. bsz1208 Lv 1 1 pt. 9,161
  2. Avatar for TurnerK25 52. TurnerK25 Lv 1 1 pt. 9,109
  3. Avatar for CAN1958 53. CAN1958 Lv 1 1 pt. 9,055
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 9,022
  5. Avatar for prkfour 55. prkfour Lv 1 1 pt. 8,774
  6. Avatar for yedy00 56. yedy00 Lv 1 1 pt. 8,701
  7. Avatar for furi0us 57. furi0us Lv 1 1 pt. 8,487
  8. Avatar for momadoc 58. momadoc Lv 1 1 pt. 8,480
  9. Avatar for CMX2KS 59. CMX2KS Lv 1 1 pt. 8,458
  10. Avatar for fact0rial 60. fact0rial Lv 1 1 pt. 8,253

Comments