Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,447
  2. Avatar for SHELL 12. SHELL 1 pt. 8,225
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,117
  4. Avatar for BearCorp 14. BearCorp 1 pt. 7,600
  1. Avatar for u202242542 61. u202242542 Lv 1 1 pt. 8,225
  2. Avatar for Sammy3c2b1a0 62. Sammy3c2b1a0 Lv 1 1 pt. 8,117
  3. Avatar for WookieeCookie27 63. WookieeCookie27 Lv 1 1 pt. 8,068
  4. Avatar for ryimax 64. ryimax Lv 1 1 pt. 7,853
  5. Avatar for Proteinbuilder67 65. Proteinbuilder67 Lv 1 1 pt. 7,845
  6. Avatar for drjr 66. drjr Lv 1 1 pt. 7,659
  7. Avatar for Russbear 67. Russbear Lv 1 1 pt. 7,600
  8. Avatar for wingeddreamer 68. wingeddreamer Lv 1 1 pt. 5,556
  9. Avatar for roarshock 69. roarshock Lv 1 1 pt. 5,122
  10. Avatar for braedendowns 70. braedendowns Lv 1 1 pt. 5,122

Comments