Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,732
  2. Avatar for Go Science 2. Go Science 68 pts. 10,567
  3. Avatar for Contenders 3. Contenders 44 pts. 10,460
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,368
  5. Avatar for Australia 5. Australia 16 pts. 10,336
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,310
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 10,261
  8. Avatar for VeFold 8. VeFold 3 pts. 10,208
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,183
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,094

  1. Avatar for JuliaBCollet 21. JuliaBCollet Lv 1 19 pts. 10,208
  2. Avatar for Joanna_H 22. Joanna_H Lv 1 17 pts. 10,183
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 15 pts. 10,182
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 14 pts. 10,162
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 12 pts. 10,129
  6. Avatar for alcor29 26. alcor29 Lv 1 11 pts. 10,118
  7. Avatar for BarrySampson 27. BarrySampson Lv 1 10 pts. 10,114
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 9 pts. 10,094
  9. Avatar for Larini 29. Larini Lv 1 8 pts. 10,057
  10. Avatar for Dr.Sillem 30. Dr.Sillem Lv 1 7 pts. 9,959

Comments