Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 19,658
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 17,817

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 21,798
  2. Avatar for spvincent 2. spvincent Lv 1 93 pts. 21,702
  3. Avatar for zeroblue 3. zeroblue Lv 1 87 pts. 21,620
  4. Avatar for LociOiling 4. LociOiling Lv 1 80 pts. 21,589
  5. Avatar for Galaxie 5. Galaxie Lv 1 74 pts. 21,541
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 69 pts. 21,438
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 64 pts. 21,435
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 59 pts. 21,401
  9. Avatar for meatexplosion 9. meatexplosion Lv 1 54 pts. 21,401
  10. Avatar for gmn 10. gmn Lv 1 50 pts. 21,376

Comments