Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,798
  2. Avatar for Contenders 2. Contenders 63 pts. 21,760
  3. Avatar for Go Science 3. Go Science 37 pts. 21,620
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 21,438
  5. Avatar for Australia 5. Australia 11 pts. 21,188
  6. Avatar for VeFold 6. VeFold 5 pts. 21,029
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 20,996
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 20,952
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 20,535
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,791

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 21,798
  2. Avatar for spvincent 2. spvincent Lv 1 93 pts. 21,702
  3. Avatar for zeroblue 3. zeroblue Lv 1 87 pts. 21,620
  4. Avatar for LociOiling 4. LociOiling Lv 1 80 pts. 21,589
  5. Avatar for Galaxie 5. Galaxie Lv 1 74 pts. 21,541
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 69 pts. 21,438
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 64 pts. 21,435
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 59 pts. 21,401
  9. Avatar for meatexplosion 9. meatexplosion Lv 1 54 pts. 21,401
  10. Avatar for gmn 10. gmn Lv 1 50 pts. 21,376

Comments