Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,798
  2. Avatar for Contenders 2. Contenders 63 pts. 21,760
  3. Avatar for Go Science 3. Go Science 37 pts. 21,620
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 21,438
  5. Avatar for Australia 5. Australia 11 pts. 21,188
  6. Avatar for VeFold 6. VeFold 5 pts. 21,029
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 20,996
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 20,952
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 20,535
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,791

  1. Avatar for DScott 51. DScott Lv 1 1 pt. 18,584
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 18,499
  3. Avatar for ucad 53. ucad Lv 1 1 pt. 18,330
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 18,180
  5. Avatar for Merf 55. Merf Lv 1 1 pt. 18,123
  6. Avatar for glaminator 56. glaminator Lv 1 1 pt. 17,874
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 17,853
  8. Avatar for Sammy3c2b1a0 58. Sammy3c2b1a0 Lv 1 1 pt. 17,817
  9. Avatar for furi0us 59. furi0us Lv 1 1 pt. 17,759
  10. Avatar for RWoodcock 60. RWoodcock Lv 1 1 pt. 17,617

Comments