Placeholder image of a protein
Icon representing a puzzle

2596: Electron Density Reconstruction 114

Closed since about 1 year ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is large, so we highly recommend using the Trim tool. It's also unusual that the four proteins are separated in space. As a result, this puzzle will be open for two weeks.

Sequence
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Top groups


  1. Avatar for Contenders 100 pts. 140,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 139,731
  3. Avatar for Go Science 3. Go Science 37 pts. 139,260
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 138,832
  5. Avatar for Australia 5. Australia 11 pts. 136,336
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 135,205
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 135,193
  8. Avatar for VeFold 8. VeFold 1 pt. 133,902
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 133,153
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 63,152

Comments


zeroblue Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891

bravosk8erboy Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891

beta_helix Staff Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891

zeroblue Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2596: Electron Density Reconstruction 114
4  puckers found!
pucker 1 (ideality), segments 315-316 (protein), distance = 5.597, ideality = -12072.761, -12074.463
pucker 2 (ideality), segments 680-681 (protein), distance = 8.991, ideality = -16897.966, -16896.571
pucker 3 (ideality), segments 1045-1046 (protein), distance = 9.877, ideality = -49392.723, -49390.321
pucker 4 (ideality), segments 1410-1411 (protein), distance = 6.038, ideality = -7807.601, -7808.269

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2596: Electron Density Reconstruction 114
4  puckers found!
pucker 1 (ideality), segments 315-316 (protein), distance = 5.597, ideality = -12072.761, -12074.463
pucker 2 (ideality), segments 680-681 (protein), distance = 8.991, ideality = -16897.966, -16896.571
pucker 3 (ideality), segments 1045-1046 (protein), distance = 9.877, ideality = -49392.723, -49390.321
pucker 4 (ideality), segments 1410-1411 (protein), distance = 6.038, ideality = -7807.601, -7808.269

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2596: Electron Density Reconstruction 114
4  puckers found!
pucker 1 (ideality), segments 315-316 (protein), distance = 5.597, ideality = -12072.761, -12074.463
pucker 2 (ideality), segments 680-681 (protein), distance = 8.991, ideality = -16897.966, -16896.571
pucker 3 (ideality), segments 1045-1046 (protein), distance = 9.877, ideality = -49392.723, -49390.321
pucker 4 (ideality), segments 1410-1411 (protein), distance = 6.038, ideality = -7807.601, -7808.269