Placeholder image of a protein
Icon representing a puzzle

2601: Electron Density Reconstruction 115

Closed since 11 months ago

Novice Overall Prediction Electron Density

Summary

Created
April 09, 2025
Expires
Max points
100
Description

The structure of this protein and bound DNA has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGAGAAGA ATCTTCTCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 19,917
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 19,909
  3. Avatar for Go Science 3. Go Science 29 pts. 19,872
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 14 pts. 19,872
  5. Avatar for Gargleblasters 5. Gargleblasters 6 pts. 19,842
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 19,805
  7. Avatar for Australia 7. Australia 1 pt. 19,780
  8. Avatar for Contenders 8. Contenders 1 pt. 19,776
  9. Avatar for VeFold 9. VeFold 1 pt. 19,774
  10. Avatar for Intellectual decay of Brazil (IDEB) 10. Intellectual decay of Brazil (IDEB) 1 pt. 14,941
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 19,909
  2. Avatar for Galaxie 2. Galaxie Lv 1 41 pts. 19,897
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 14 pts. 19,872
  4. Avatar for alcor29 4. alcor29 Lv 1 4 pts. 19,867
  5. Avatar for Anfinsen_slept_here 5. Anfinsen_slept_here Lv 1 1 pt. 19,727
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 19,631
  7. Avatar for toshiue 7. toshiue Lv 1 1 pt. 19,119

Comments