2601: Electron Density Reconstruction 115
Closed since 12 months ago
Novice Overall Prediction Electron DensitySummary
- Created
- April 09, 2025
- Expires
- Max points
- 100
The structure of this protein and bound DNA has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.
- Sequence
- TGTTTTTGAGAAGA ATCTTCTCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN
Top groups
-
100 pts. 19,917
-
-
-
-
-
-
-
-
-