Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups



  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 11,237
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 11,188
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 89 pts. 11,179
  4. Avatar for LociOiling 4. LociOiling Lv 1 83 pts. 11,162
  5. Avatar for Galaxie 5. Galaxie Lv 1 78 pts. 11,162
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 73 pts. 11,138
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 68 pts. 11,126
  8. Avatar for gmn 8. gmn Lv 1 64 pts. 11,117
  9. Avatar for akaaka 9. akaaka Lv 1 60 pts. 11,090
  10. Avatar for grogar7 10. grogar7 Lv 1 56 pts. 11,082

Comments