Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Go Science 100 pts. 11,194
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,162
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 11,056
  4. Avatar for Australia 4. Australia 24 pts. 10,991
  5. Avatar for Contenders 5. Contenders 14 pts. 10,970
  6. Avatar for VeFold 6. VeFold 7 pts. 10,932
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,927
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,846
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,760
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,686

  1. Avatar for heather-1 31. heather-1 Lv 1 10 pts. 10,640
  2. Avatar for toshiue 32. toshiue Lv 1 9 pts. 10,637
  3. Avatar for hookedwarm 33. hookedwarm Lv 1 8 pts. 10,602
  4. Avatar for LadyCrazy 34. LadyCrazy Lv 1 7 pts. 10,579
  5. Avatar for borattt 35. borattt Lv 1 7 pts. 10,568
  6. Avatar for Idiotboy 36. Idiotboy Lv 1 6 pts. 10,567
  7. Avatar for pizpot 37. pizpot Lv 1 6 pts. 10,516
  8. Avatar for Hellcat6 38. Hellcat6 Lv 1 5 pts. 10,506
  9. Avatar for hada 39. hada Lv 1 4 pts. 10,467
  10. Avatar for badgoes 40. badgoes Lv 1 4 pts. 10,461

Comments