Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since 12 months ago

Novice Overall Prediction

Summary


Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Go Science 100 pts. 11,194
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,162
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 11,056
  4. Avatar for Australia 4. Australia 24 pts. 10,991
  5. Avatar for Contenders 5. Contenders 14 pts. 10,970
  6. Avatar for VeFold 6. VeFold 7 pts. 10,932
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,927
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,846
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,760
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,686

  1. Avatar for jausmh 51. jausmh Lv 1 1 pt. 10,144
  2. Avatar for pfirth 52. pfirth Lv 1 1 pt. 10,108
  3. Avatar for CAN1958 53. CAN1958 Lv 1 1 pt. 10,045
  4. Avatar for zbp 54. zbp Lv 1 1 pt. 9,884
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 9,861
  6. Avatar for Rato_Atomico87 56. Rato_Atomico87 Lv 1 1 pt. 9,797
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 9,764
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 9,729
  9. Avatar for Fasodankfds 59. Fasodankfds Lv 1 1 pt. 9,687
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 9,651

Comments