Placeholder image of a protein
Icon representing a puzzle

2607:Electron Density Reconstruction 117

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 29, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is fairly large, so we highly recommend using the Trim tool.

Sequence
EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIAAAFAMLSLGAKGDTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 36,133
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 34,736

  1. Avatar for akaaka 11. akaaka Lv 1 47 pts. 40,358
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 44 pts. 40,284
  3. Avatar for jausmh 13. jausmh Lv 1 40 pts. 40,275
  4. Avatar for ZeroLeak7 14. ZeroLeak7 Lv 1 37 pts. 40,189
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 34 pts. 40,154
  6. Avatar for meatexplosion 16. meatexplosion Lv 1 31 pts. 40,050
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 28 pts. 40,044
  8. Avatar for nicobul 18. nicobul Lv 1 26 pts. 39,962
  9. Avatar for MicElephant 19. MicElephant Lv 1 24 pts. 39,698
  10. Avatar for TheGUmmer 20. TheGUmmer Lv 1 22 pts. 39,598

Comments


LociOiling Lv 1

The newly launched AA Edit 3.0 reveals this is PDB 1KCT.

The details:

Puzzle: 2607:Electron Density Reconstruction 117
segment count = 375
1 chains and ligands
chain A (protein), segments 1-375, length = 375
hptfnkitpnlaefafslyrqlahqsnstniffspvsiaaafamlslgakgdthdeileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntksplfmgkvvnptqk

BootsMcGraw Lv 1

This puzzle is constantly crashing the game while a script is running. Doesn't matter what script it is.. Anyone else experiencing it?