Placeholder image of a protein
Icon representing a puzzle

2607:Electron Density Reconstruction 117

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 29, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is fairly large, so we highly recommend using the Trim tool.

Sequence
EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIAAAFAMLSLGAKGDTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 36,133
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 34,736

  1. Avatar for alcor29 21. alcor29 Lv 1 20 pts. 39,253
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 18 pts. 39,186
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 16 pts. 39,135
  4. Avatar for toshiue 24. toshiue Lv 1 15 pts. 38,697
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 13 pts. 38,696
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 12 pts. 38,462
  7. Avatar for vs 27. vs Lv 1 11 pts. 38,318
  8. Avatar for jamiexq 28. jamiexq Lv 1 10 pts. 38,296
  9. Avatar for Joanna_H 29. Joanna_H Lv 1 9 pts. 37,924
  10. Avatar for JuliaBCollet 30. JuliaBCollet Lv 1 8 pts. 37,785

Comments


LociOiling Lv 1

The newly launched AA Edit 3.0 reveals this is PDB 1KCT.

The details:

Puzzle: 2607:Electron Density Reconstruction 117
segment count = 375
1 chains and ligands
chain A (protein), segments 1-375, length = 375
hptfnkitpnlaefafslyrqlahqsnstniffspvsiaaafamlslgakgdthdeileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntksplfmgkvvnptqk

BootsMcGraw Lv 1

This puzzle is constantly crashing the game while a script is running. Doesn't matter what script it is.. Anyone else experiencing it?