Placeholder image of a protein
Icon representing a puzzle

2607:Electron Density Reconstruction 117

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 29, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is fairly large, so we highly recommend using the Trim tool.

Sequence
EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIAAAFAMLSLGAKGDTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 36,133
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 34,736

  1. Avatar for rinze 51. rinze Lv 1 1 pt. 34,082
  2. Avatar for Hellcat6 52. Hellcat6 Lv 1 1 pt. 33,474
  3. Avatar for RWoodcock 53. RWoodcock Lv 1 1 pt. 33,326
  4. Avatar for futsall 54. futsall Lv 1 1 pt. 33,228
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 1 pt. 33,200
  6. Avatar for carxo 56. carxo Lv 1 1 pt. 33,147
  7. Avatar for xspectrum 57. xspectrum Lv 1 1 pt. 33,065
  8. Avatar for zbp 58. zbp Lv 1 1 pt. 33,008
  9. Avatar for efull 59. efull Lv 1 1 pt. 32,983
  10. Avatar for Swapper242 60. Swapper242 Lv 1 1 pt. 32,314

Comments


LociOiling Lv 1

The newly launched AA Edit 3.0 reveals this is PDB 1KCT.

The details:

Puzzle: 2607:Electron Density Reconstruction 117
segment count = 375
1 chains and ligands
chain A (protein), segments 1-375, length = 375
hptfnkitpnlaefafslyrqlahqsnstniffspvsiaaafamlslgakgdthdeileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntksplfmgkvvnptqk

BootsMcGraw Lv 1

This puzzle is constantly crashing the game while a script is running. Doesn't matter what script it is.. Anyone else experiencing it?