Placeholder image of a protein
Icon representing a puzzle

2607:Electron Density Reconstruction 117

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 29, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is fairly large, so we highly recommend using the Trim tool.

Sequence
EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIAAAFAMLSLGAKGDTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Top groups


  1. Avatar for Contenders 100 pts. 41,228
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 41,213
  3. Avatar for Go Science 3. Go Science 37 pts. 41,100
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 40,636
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 40,275
  6. Avatar for VeFold 6. VeFold 5 pts. 40,189
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 40,154
  8. Avatar for Australia 8. Australia 1 pt. 40,044
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 39,598
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 37,924

  1. Avatar for Trajan464 41. Trajan464 Lv 1 2 pts. 36,156
  2. Avatar for psyi 42. psyi Lv 1 2 pts. 36,133
  3. Avatar for LHOr 43. LHOr Lv 1 2 pts. 35,816
  4. Avatar for Larini 44. Larini Lv 1 1 pt. 35,651
  5. Avatar for pizpot 45. pizpot Lv 1 1 pt. 34,760
  6. Avatar for zanbato 46. zanbato Lv 1 1 pt. 34,736
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 34,594
  8. Avatar for froschi2 48. froschi2 Lv 1 1 pt. 34,390
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 34,388
  10. Avatar for DScott 50. DScott Lv 1 1 pt. 34,246

Comments


LociOiling Lv 1

The newly launched AA Edit 3.0 reveals this is PDB 1KCT.

The details:

Puzzle: 2607:Electron Density Reconstruction 117
segment count = 375
1 chains and ligands
chain A (protein), segments 1-375, length = 375
hptfnkitpnlaefafslyrqlahqsnstniffspvsiaaafamlslgakgdthdeileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntksplfmgkvvnptqk

BootsMcGraw Lv 1

This puzzle is constantly crashing the game while a script is running. Doesn't matter what script it is.. Anyone else experiencing it?