Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 11 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups



  1. Avatar for akaaka
    1. akaaka Lv 1
    100 pts. 9,802
  2. Avatar for vs 2. vs Lv 1 94 pts. 9,795
  3. Avatar for SemperRabbit 3. SemperRabbit Lv 1 88 pts. 9,792
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 83 pts. 9,787
  5. Avatar for Serca 5. Serca Lv 1 78 pts. 9,785
  6. Avatar for LociOiling 6. LociOiling Lv 1 73 pts. 9,777
  7. Avatar for gmn 7. gmn Lv 1 68 pts. 9,769
  8. Avatar for AlkiP0Ps 8. AlkiP0Ps Lv 1 63 pts. 9,769
  9. Avatar for Galaxie 9. Galaxie Lv 1 59 pts. 9,767
  10. Avatar for WBarme1234 10. WBarme1234 Lv 1 55 pts. 9,764

Comments