Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Intellectual decay of Brazil (IDEB) 11. Intellectual decay of Brazil (IDEB) 1 pt. 8,839
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 51 pts. 9,763
  2. Avatar for TheGUmmer 12. TheGUmmer Lv 1 48 pts. 9,755
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 44 pts. 9,754
  4. Avatar for meatexplosion 14. meatexplosion Lv 1 41 pts. 9,742
  5. Avatar for grogar7 15. grogar7 Lv 1 38 pts. 9,733
  6. Avatar for bravosk8erboy 16. bravosk8erboy Lv 1 35 pts. 9,732
  7. Avatar for LHOr 17. LHOr Lv 1 33 pts. 9,731
  8. Avatar for BarrySampson 18. BarrySampson Lv 1 30 pts. 9,729
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 28 pts. 9,728
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 26 pts. 9,708

Comments