Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups



  1. Avatar for Osiris 51. Osiris Lv 1 1 pt. 9,456
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 9,388
  3. Avatar for ProfVince 53. ProfVince Lv 1 1 pt. 9,382
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 1 pt. 9,345
  5. Avatar for pfirth 55. pfirth Lv 1 1 pt. 9,340
  6. Avatar for rosie4loop 56. rosie4loop Lv 1 1 pt. 9,313
  7. Avatar for ucad 57. ucad Lv 1 1 pt. 9,305
  8. Avatar for Simek 58. Simek Lv 1 1 pt. 9,303
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 9,297
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 9,292

Comments