Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 11 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,796
  2. Avatar for Go Science 2. Go Science 60 pts. 9,787
  3. Avatar for Australia 3. Australia 33 pts. 9,769
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 9,764
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,755
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,754
  7. Avatar for VeFold 7. VeFold 2 pts. 9,729
  8. Avatar for Contenders 8. Contenders 1 pt. 9,708
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,703
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,660

  1. Avatar for manu8170 21. manu8170 Lv 1 24 pts. 9,707
  2. Avatar for Joanna_H 22. Joanna_H Lv 1 22 pts. 9,703
  3. Avatar for g_b 23. g_b Lv 1 20 pts. 9,692
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 18 pts. 9,688
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 17 pts. 9,675
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 15 pts. 9,670
  7. Avatar for AlphaFold2 27. AlphaFold2 Lv 1 14 pts. 9,669
  8. Avatar for MicElephant 28. MicElephant Lv 1 13 pts. 9,666
  9. Avatar for JuliaBCollet 29. JuliaBCollet Lv 1 12 pts. 9,661
  10. Avatar for orily1337 30. orily1337 Lv 1 11 pts. 9,660

Comments