Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 11 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,796
  2. Avatar for Go Science 2. Go Science 60 pts. 9,787
  3. Avatar for Australia 3. Australia 33 pts. 9,769
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 9,764
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,755
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,754
  7. Avatar for VeFold 7. VeFold 2 pts. 9,729
  8. Avatar for Contenders 8. Contenders 1 pt. 9,708
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,703
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,660

  1. Avatar for jamiexq 31. jamiexq Lv 1 10 pts. 9,653
  2. Avatar for SuperEnzyme 32. SuperEnzyme Lv 1 9 pts. 9,631
  3. Avatar for alcor29 33. alcor29 Lv 1 8 pts. 9,627
  4. Avatar for hansvandenhof 34. hansvandenhof Lv 1 7 pts. 9,612
  5. Avatar for badgoes 35. badgoes Lv 1 6 pts. 9,612
  6. Avatar for zbp 37. zbp Lv 1 5 pts. 9,589
  7. Avatar for Crossed Sticks 38. Crossed Sticks Lv 1 5 pts. 9,588
  8. Avatar for LadyCrazy 39. LadyCrazy Lv 1 4 pts. 9,580
  9. Avatar for Alistair69 40. Alistair69 Lv 1 4 pts. 9,573

Comments