Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 11 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,796
  2. Avatar for Go Science 2. Go Science 60 pts. 9,787
  3. Avatar for Australia 3. Australia 33 pts. 9,769
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 9,764
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,755
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,754
  7. Avatar for VeFold 7. VeFold 2 pts. 9,729
  8. Avatar for Contenders 8. Contenders 1 pt. 9,708
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,703
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,660

  1. Avatar for DScott 61. DScott Lv 1 1 pt. 9,284
  2. Avatar for Dr.Sillem 62. Dr.Sillem Lv 1 1 pt. 9,261
  3. Avatar for Merf 63. Merf Lv 1 1 pt. 9,248
  4. Avatar for JellyfisHawthorn 64. JellyfisHawthorn Lv 1 1 pt. 9,018
  5. Avatar for Fasodankfds 65. Fasodankfds Lv 1 1 pt. 9,007
  6. Avatar for rinze 66. rinze Lv 1 1 pt. 8,982
  7. Avatar for WuWTq 67. WuWTq Lv 1 1 pt. 8,967
  8. Avatar for carxo 68. carxo Lv 1 1 pt. 8,876
  9. Avatar for DH160 69. DH160 Lv 1 1 pt. 8,856
  10. Avatar for prkfour 70. prkfour Lv 1 1 pt. 8,847

Comments