Placeholder image of a protein
Icon representing a puzzle

2610: Electron Density Reconstruction 118

Closed since 12 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 07, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It has 5 parts, and several of the segments won't be visible as they are missing in the data.

Sequence
PGPPQGPPQPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFWWKNCKM GKSASGIIMETQQAKQTLADIEARHADIMKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEAAVDYIETAKVDTKKAVKYQSKAR NGEVEVPKTELEEIQQQCNQVTDDSLESTRRMLNMCEESKEAGIRTLVMLDEQGEQLDRIEEGLDQINQDMKDAEKNLEGMEK VTVGDQNGMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVDRIQQKAESNESRIDEANKKATKLLKN GKSASGEKEGNENAEEEAAAIEEARREAEERRKEKHRKMEEEREEMRQTIRDKYGLKKKVKEEPEAEADLDEGRVGRKK

Top groups


  1. Avatar for GENE 433 12. GENE 433 1 pt. 37,465
  2. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 37,212

  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 41,498
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 93 pts. 41,224
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 87 pts. 41,117
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 81 pts. 41,107
  5. Avatar for akaaka 5. akaaka Lv 1 75 pts. 41,101
  6. Avatar for grogar7 6. grogar7 Lv 1 69 pts. 41,093
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 64 pts. 41,069
  8. Avatar for spvincent 8. spvincent Lv 1 59 pts. 41,056
  9. Avatar for LociOiling 9. LociOiling Lv 1 55 pts. 40,996
  10. Avatar for Galaxie 10. Galaxie Lv 1 50 pts. 40,959

Comments