Placeholder image of a protein
Icon representing a puzzle

2610: Electron Density Reconstruction 118

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 07, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It has 5 parts, and several of the segments won't be visible as they are missing in the data.

Sequence
PGPPQGPPQPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFWWKNCKM GKSASGIIMETQQAKQTLADIEARHADIMKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEAAVDYIETAKVDTKKAVKYQSKAR NGEVEVPKTELEEIQQQCNQVTDDSLESTRRMLNMCEESKEAGIRTLVMLDEQGEQLDRIEEGLDQINQDMKDAEKNLEGMEK VTVGDQNGMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVDRIQQKAESNESRIDEANKKATKLLKN GKSASGEKEGNENAEEEAAAIEEARREAEERRKEKHRKMEEEREEMRQTIRDKYGLKKKVKEEPEAEADLDEGRVGRKK

Top groups


  1. Avatar for Go Science 100 pts. 41,518
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 41,117
  3. Avatar for VeFold 3. VeFold 41 pts. 41,107
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 41,093
  5. Avatar for Contenders 5. Contenders 14 pts. 41,056
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 40,761
  7. Avatar for Australia 7. Australia 4 pts. 40,667
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 40,612
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 40,588
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 40,563

  1. Avatar for nancy_naniewoo 41. nancy_naniewoo Lv 1 2 pts. 39,181
  2. Avatar for Rato_Atomico87 42. Rato_Atomico87 Lv 1 2 pts. 39,115
  3. Avatar for vybi 43. vybi Lv 1 1 pt. 39,100
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 1 pt. 39,069
  5. Avatar for hada 45. hada Lv 1 1 pt. 39,068
  6. Avatar for ProfVince 46. ProfVince Lv 1 1 pt. 39,040
  7. Avatar for Crossed Sticks 47. Crossed Sticks Lv 1 1 pt. 39,024
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 38,985
  9. Avatar for Tian00 49. Tian00 Lv 1 1 pt. 38,889
  10. Avatar for pizpot 50. pizpot Lv 1 1 pt. 38,858

Comments