Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714
  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 10,200
  2. Avatar for SemperRabbit 2. SemperRabbit Lv 1 94 pts. 10,198
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 88 pts. 10,195
  4. Avatar for akaaka 4. akaaka Lv 1 83 pts. 10,181
  5. Avatar for Serca 5. Serca Lv 1 77 pts. 10,176
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 72 pts. 10,162
  7. Avatar for MicElephant 7. MicElephant Lv 1 68 pts. 10,157
  8. Avatar for LociOiling 8. LociOiling Lv 1 63 pts. 10,155
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 59 pts. 10,148
  10. Avatar for meatexplosion 10. meatexplosion Lv 1 55 pts. 10,145

Comments